NICE2 (S100A7A) (NM_176823) Human Recombinant Protein

SKU
TP321177
Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221177 representing NM_176823
Red=Cloning site Green=Tags(s)

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI
DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_789793
Locus ID 338324
UniProt ID Q86SG5
Cytogenetics 1q21.3
RefSeq Size 4351
RefSeq ORF 303
Synonyms NICE-2; NICE2; S100A7f; S100A7L1; S100A15
Summary May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NICE2 (S100A7A) (NM_176823) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH321177 S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793) 10 ug
$3,255.00
LC406111 S100A7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406111 Transient overexpression lysate of S100 calcium binding protein A7A (S100A7A) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.