NICE2 (S100A7A) (NM_176823) Human Mass Spec Standard

SKU
PH321177
S100A7A MS Standard C13 and N15-labeled recombinant protein (NP_789793)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC221177]
Predicted MW 11.1 kDa
Protein Sequence
Protein Sequence
>RC221177 representing NM_176823
Red=Cloning site Green=Tags(s)

MSNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKI
DFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_789793
RefSeq Size 4351
RefSeq ORF 303
Synonyms NICE-2; NICE2; S100A7f; S100A7L1; S100A15
Locus ID 338324
UniProt ID Q86SG5
Cytogenetics 1q21.3
Summary May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:NICE2 (S100A7A) (NM_176823) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC406111 S100A7A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY406111 Transient overexpression lysate of S100 calcium binding protein A7A (S100A7A) 100 ug
$436.00
TP321177 Recombinant protein of human S100 calcium binding protein A7A (S100A7A), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.