OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

COASY (NM_025233) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320733
Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA503344 COASY mouse monoclonal antibody, clone OTI3B3 (formerly 3B3) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "COASY or NM_025233"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220733 representing NM_025233
Red=Cloning site Green=Tags(s)

MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQYSPVQATFEVLDFITH
LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC
YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL
LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP
SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE
RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV
IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH
QALD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 62.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_079509
Locus ID 80347
UniProt ID Q13057
Cytogenetics 17q21.2
RefSeq Size 2470
RefSeq ORF 1692
Synonyms DPCK; NBIA6; NBP; PCH12; pOV-2; PPAT; UKR1
Summary Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. provided by RefSeq, Apr 2014
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "COASY" proteins (14)
SKU Description Size Price
PH309424 COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035995) 10 ug
$3,360.00
PH315228 COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035994) 10 ug
$3,360.00
PH320733 COASY MS Standard C13 and N15-labeled recombinant protein (NP_079509) 10 ug
$3,360.00
LC403068 Lyophilized COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420963 Lyophilized COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420964 Lyophilized COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425767 Lyophilized COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403068 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1 (as WB positive control) 100 ug
$436.00
LY420963 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2 (as WB positive control) 100 ug
$665.00
LY420964 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 (as WB positive control) 100 ug
$436.00
LY425767 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 (as WB positive control) 100 ug
$436.00
TP309424 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg 20 ug
$867.00
TP315228 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$867.00
TP315287 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 5, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products