COASY (NM_001042530) Human Mass Spec Standard

SKU
PH309424
COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035995)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC209424]
Predicted MW 62.4 kDa
Protein Sequence
Protein Sequence
>RC209424 protein sequence
Red=Cloning site Green=Tags(s)

MAVFRSGLLVLTTPLASLAPRLASILTSAARLVNHTLYVHLQPGMSLEGPAQPQYSPVQATFEVLDFITH
LYAGADVHRHLDVRILLTNIRTKSTFLPPLPTSVQNLAHPPEVVLTDFQTLDGSQYNPVKQQLVRYATSC
YSCCPRLASVLLYSDYGIGEVPVEPLDVPLPSTIRPASPVAGSPKQPVRGYYRGAVGGTFDRLHNAHKVL
LSVACILAQEQLVVGVADKDLLKSKLLPELLQPYTERVEHLSEFLVDIKPSLTFDVIPLLDPYGPAGSDP
SLEFLVVSEETYRGGMAINRFRLENDLEELALYQIQLLKDLRHTENEEDKVSSSSFRQRMLGNLLRPPYE
RPELPTCLYVIGLTGISGSGKSSIAQRLKGLGAFVIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKDGI
INRKVLGSRVFGNKKQLKILTDIMWPIIAKLAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLVHEVWTAV
IPETEAVRRIVERDGLSEAAAQSRLQSQMSGQQLVEQSHVVLSTLWEPHITQRQVEKAWALLQKRIPKTH
QALD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001035995
RefSeq Size 2417
RefSeq ORF 1692
Synonyms DPCK; FLJ35179; NBP; pOV-2; PPAT; UKR1
Locus ID 80347
UniProt ID Q13057
Cytogenetics 17q21.2
Summary Coenzyme A (CoA) functions as a carrier of acetyl and acyl groups in cells and thus plays an important role in numerous synthetic and degradative metabolic pathways in all organisms. In eukaryotes, CoA and its derivatives are also involved in membrane trafficking and signal transduction. This gene encodes the bifunctional protein coenzyme A synthase (CoAsy) which carries out the last two steps in the biosynthesis of CoA from pantothenic acid (vitamin B5). The phosphopantetheine adenylyltransferase domain of this bifunctional protein catalyzes the conversion of 4'-phosphopantetheine into dephospho-coenzyme A (dpCoA) while its dephospho-CoA kinase domain completes the final step by phosphorylating dpCoA to form CoA. Mutations in this gene are associated with neurodegeneration with brain iron accumulation (NBIA). Alternative splicing results in multiple isoforms. [provided by RefSeq, Apr 2014]
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis
Write Your Own Review
You're reviewing:COASY (NM_001042530) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315228 COASY MS Standard C13 and N15-labeled recombinant protein (NP_001035994) 10 ug
$3,255.00
PH320733 COASY MS Standard C13 and N15-labeled recombinant protein (NP_079509) 10 ug
$3,255.00
LC403068 COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420963 COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420964 COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425766 COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC425767 COASY HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY403068 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY420963 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$665.00
LY420964 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$436.00
LY425767 Transient overexpression lysate of Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3 100 ug
$436.00
TP309424 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315228 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP315287 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 5, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP320733 Recombinant protein of human Coenzyme A synthase (COASY), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.