OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Rubicon (RUBCN) (NM_014687) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320593
Purified recombinant protein of Homo sapiens KIAA0226 (KIAA0226), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA349091 Rabbit Polyclonal Anti-Rubicon Antibody
100 ug
$640.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Rubicon or NM_014687"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220593 representing NM_014687
Red=Cloning site Green=Tags(s)

MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLI
RDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLR
PLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTAL
PSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSV
SALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS
SNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP
ESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLE
KENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQEAEH
GSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVA
MGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQI
IFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSK
YYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVP
GHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCR
TCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 108.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_055502
Locus ID 9711
UniProt ID Q92622
Cytogenetics 3q29
RefSeq Size 6732
RefSeq ORF 2916
Synonyms KIAA0226; RUBICON; SCAR15
Summary The protein encoded by this gene is a negative regulator of autophagy and endocytic trafficking and controls endosome maturation. This protein contains two conserved domains, an N-terminal RUN domain and a C-terminal DUF4206 domain. The RUN domain is involved in Ras-like GTPase signaling, and the DUF4206 domain contains a diacylglycerol (DAG) binding-like motif. Mutation in this gene results in deletion of the DAG binding-like motif and causes a recessive ataxia. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, Apr 2014
Protein Categories Intracellular Proteins, Nervous system: Neurodegenerative diseases
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Rubicon" proteins (4)
SKU Description Size Price
PH320593 KIAA0226 MS Standard C13 and N15-labeled recombinant protein (NP_055502) 10 ug
$3,360.00
LC415105 Lyophilized KIAA0226 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415105 Transient overexpression lysate of KIAA0226 (KIAA0226), transcript variant 2 (as WB positive control) 100 ug
$665.00
TP762693 Purified recombinant protein of Human KIAA0226 (KIAA0226), transcript variant 2, full length, with N-GST and C-His tag, expressed in E.coli, 50ug 50 ug
$270.00

file-alt Citations

A ZFYVE21-Rubicon-RNF34 signaling complex promotes endosome-associated inflammasome activity in endothelial cells
Li, Jiang, Song et al
Nat Commun (2023) 14 (1), 3002 DOI: 10.1038/s41467-023-38684-2
Cited by 8
AI Summary: OriGene’s Rubicon-GST protein (#TP320593) was used in cell-free protein co-incubation studies to investigate the assembly and interactions of the ZFYVE21-Rubicon-RNF34 (ZRR) signaling complex that regulates inflammasome activity in endothelial cells.
Snippet: hnology, #sc-392736), cleaved caspase-1 (Cell Signaling, #4199S), and β-actin (Sigma, #A5316-100 μL). Cell-free analyses of ZRR complexes For protein co-incubation studies, Rubcion-GST (1 μg, Origene, #TP320593) and RNF34-His proteins (1 μg, Novus, #NBP2-23440) were co-incubated at 1:1 ratio at a volume of 50 μL at room temperature overnight with gentle rocking prior to resolution by
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products