OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAX (NM_145113) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP320343
Recombinant protein of human MYC associated factor X (MAX), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA815026 MAX mouse monoclonal antibody,clone OTI14G1 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MAX or NM_145113"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC220343 representing NM_145113
Red=Cloning site Green=Tags(s)

MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKPQASRAQILDKAT
EYIQYMRRKNHTHQQDIDDLKRQNALLEQQGESES

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_660088
Locus ID 4149
UniProt ID P61244
Cytogenetics 14q23.3
RefSeq Size 2169
RefSeq ORF 315
Synonyms bHLHd4
Summary The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2012
Protein Categories Cancer: Endocrine, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway, Pathways in cancer, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAX" proteins (17)
SKU Description Size Price
PH303944 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089) 10 ug
$3,360.00
PH306294 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660092) 10 ug
$3,360.00
PH306812 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660087) 10 ug
$3,360.00
PH320343 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660088) 10 ug
$3,360.00
LC408018 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408019 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408020 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408022 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408018 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY408019 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY408020 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY408022 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP303944 Recombinant protein of human MYC associated factor X (MAX), transcript variant 4, 20 µg 20 ug
$867.00
TP306294 Recombinant protein of human MYC associated factor X (MAX), transcript variant 5, 20 µg 20 ug
$867.00
TP306812 Recombinant protein of human MYC associated factor X (MAX), transcript variant 2, 20 µg 20 ug
$867.00
TP720173 Recombinant protein of human MYC associated factor X (MAX), transcript variant 1 10 ug
$275.00
TP761118 Purified recombinant protein of Human MYC associated factor X (MAX), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

WASp modulates RPA function on single-stranded DNA in response to replication stress and DNA damage
Han, Wen, García-Rubio et al
Nat Commun (2022) 13 (1), 3743 DOI: 10.1038/s41467-022-31415-z
Cited by 37
AI Summary: OriGene products, specifically RPA1 (TP302066), RPA2 (TP305715), MAX (TP320343), ARP3 (TP308460), FANCA (TP761743), XRCC2 (TP308330), DNMT1 (TP326414), MYC (TP301611), NF-κB1 (TP308384), and STAT1 (TP313858), were used as key reagents to investigate the molecular mechanisms by which WASp modulates RPA function and maintains genomic stability under replication stress and DNA damage.
Snippet: ns RPA1 (TP302066), RPA2 (TP305715), MAX (TP320343), ARP3 (TP308460), FANCA (TP761743), XRCC2 (TP308330), DNMT1 (TP326414), MYC (TP301611), NF-κB1 (TP308384) and STAT1 (TP313858) were purchased from OriGene (Rockville, MD). ARP2 (ab217837) was purchased from Abcam (Cambridge, MA). Heterotrimeric RPA and RPA1 mutant forms of RPA were expressed as recombinant protein E. coli and them purified over
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products