OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MAX (NM_145114) Human Mass Spec Standard

Be the first to review this product
SKU
PH303944
MAX MS Standard C13 and N15-labeled recombinant protein (NP_660089)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA815026 MAX mouse monoclonal antibody,clone OTI14G1 100 ul
$447.00
LY408018 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "MAX or NM_145114"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC203944
Predicted MW 11.5 kDa
Protein Sequence
Protein Sequence
>RC203944 protein sequence
Red=Cloning site Green=Tags(s)

MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKLYFLFWKLCTPVL
HRQSLMQKCHTFISSYQVHKKKECKI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_660089
RefSeq Size 937
RefSeq ORF 288
Synonyms bHLHd4
Locus ID 4149
UniProt ID P61244
Cytogenetics 14q23.3
Summary The protein encoded by this gene is a member of the basic helix-loop-helix leucine zipper (bHLHZ) family of transcription factors. It is able to form homodimers and heterodimers with other family members, which include Mad, Mxi1 and Myc. Myc is an oncoprotein implicated in cell proliferation, differentiation and apoptosis. The homodimers and heterodimers compete for a common DNA target site (the E box) and rearrangement among these dimer forms provides a complex system of transcriptional regulation. Mutations of this gene have been reported to be associated with hereditary pheochromocytoma. A pseudogene of this gene is located on the long arm of chromosome 7. Alternative splicing results in multiple transcript variants. provided by RefSeq, Aug 2012
Protein Families Druggable Genome, Transcription Factors
Protein Pathways MAPK signaling pathway, Pathways in cancer, Small cell lung cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MAX" proteins (17)
SKU Description Size Price
PH306294 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660092) 10 ug
$3,360.00
PH306812 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660087) 10 ug
$3,360.00
PH320343 MAX MS Standard C13 and N15-labeled recombinant protein (NP_660088) 10 ug
$3,360.00
LC408018 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408019 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408020 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC408022 Lyophilized MAX HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408018 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY408019 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY408020 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY408022 Transient overexpression lysate of MYC associated factor X (MAX), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP303944 Recombinant protein of human MYC associated factor X (MAX), transcript variant 4, 20 µg 20 ug
$867.00
TP306294 Recombinant protein of human MYC associated factor X (MAX), transcript variant 5, 20 µg 20 ug
$867.00
TP306812 Recombinant protein of human MYC associated factor X (MAX), transcript variant 2, 20 µg 20 ug
$867.00
TP320343 Recombinant protein of human MYC associated factor X (MAX), transcript variant 3, 20 µg 20 ug
$867.00
TP720173 Recombinant protein of human MYC associated factor X (MAX), transcript variant 1 10 ug
$275.00
TP761118 Purified recombinant protein of Human MYC associated factor X (MAX), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products