OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NEU2 (NM_005383) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319858
Recombinant protein of human sialidase 2 (cytosolic sialidase) (NEU2), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA502942 NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "NEU2 or NM_005383"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219858 representing NM_005383
Red=Cloning site Green=Tags(s)

MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA
QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR
DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH
FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP
SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Cell treatment (PMID: 29118338)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005374
Locus ID 4759
UniProt ID Q9Y3R4
Cytogenetics 2q37.1
RefSeq Size 1143
RefSeq ORF 1140
Synonyms SIAL2
Summary This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NEU2" proteins (4)
SKU Description Size Price
PH319858 NEU2 MS Standard C13 and N15-labeled recombinant protein (NP_005374) 10 ug
$3,360.00
LC401652 Lyophilized NEU2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401652 Transient overexpression lysate of sialidase 2 (cytosolic sialidase) (NEU2) (as WB positive control) 100 ug
$436.00
TP760824 Purified recombinant protein of Human sialidase 2 (cytosolic sialidase) (NEU2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

The extracellular sialidase NEU3 primes neutrophils
Kirolos, Pilling, Gomer
J Leukoc Biol (2022)
AI Summary: OriGene’s recombinant human sialidases—NEU1 (TP300386), NEU2 (TP319858), NEU3 (TP316537), and NEU4 (TP303948)—were used to test their effects on neutrophil priming, demonstrating that only NEU3 induced morphological and functional changes in human neutrophils.
Snippet: …One microliter from a 200 ng/μl stock of NEU1 (TP300386;Origene;Rockville, MD, USA), NEU2 (TP319858;Origene), NEU3 (TP316537;Origene), and NEU4 (TP303948;Origene) were each added to 0.1 ml of RPMI-1640 (Corning) to make a 2000 ng/ml solution of each. …
Attenuated pulmonary fibrosis in sialidase-3 knockout (Neu3-/-) mice
Karhadkar, Chen, Gomer
Am J Physiol Lung Cell Mol Physiol (2020) 318 (1), L165-L179 DOI: 10.1152/ajplung.00275.2019
Cited by 34
AI Summary: OriGene products contributed to this study by providing the NEU3 expression plasmid (Cat# RC216347) and NEU3-specific shRNA (Cat# TL501527), which were used to investigate the role of NEU3 in pulmonary fibrosis.
Sialidase inhibitors attenuate pulmonary fibrosis in a mouse model
Karhadkar, Pilling, Cox et al
Sci Rep (2017) 7 (1), 15069 DOI: 10.1038/s41598-017-15198-8
AI Summary: In this study, OriGene’s recombinant human NEU1, NEU2, NEU3, and NEU4 proteins were used to investigate the effects of sialidases on immune cell activity and fibrosis development in vitro.
Snippet: Where indicated, recombinant 10 ng/ml human TGF-β1 (Peprotech, Rocky Hill, NJ), 200 ng/ml recombinant human NEU1, 2, 3, or 4 (Origene, Rockville, MD), or 2 µg/ml human SAP (EMD Millipore, Billerica, MA;with the azide removed by centrifugal filters following86) were added to cells. Fibrocytes were counted as previously described29,84
FigureFigureFigure
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products