OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NEU2 (NM_005383) Human Mass Spec Standard

Be the first to review this product
SKU
PH319858
NEU2 MS Standard C13 and N15-labeled recombinant protein (NP_005374)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA502942 NEU2 mouse monoclonal antibody, clone OTI4F4 (formerly 4F4) 100 ul
$447.00
LY401652 Transient overexpression lysate of sialidase 2 (cytosolic sialidase) (NEU2) (as WB positive control) 100 ug
$436.00

Other products for "NEU2 or NM_005383"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC219858
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC219858 representing NM_005383
Red=Cloning site Green=Tags(s)

MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA
QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR
DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH
FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP
SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005374
RefSeq Size 1143
RefSeq ORF 1140
Synonyms SIAL2
Locus ID 4759
UniProt ID Q9Y3R4
Cytogenetics 2q37.1
Summary This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. provided by RefSeq, Jul 2008
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NEU2" proteins (4)
SKU Description Size Price
LC401652 Lyophilized NEU2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401652 Transient overexpression lysate of sialidase 2 (cytosolic sialidase) (NEU2) (as WB positive control) 100 ug
$436.00
TP319858 Recombinant protein of human sialidase 2 (cytosolic sialidase) (NEU2), 20 µg 20 ug
$867.00
TP760824 Purified recombinant protein of Human sialidase 2 (cytosolic sialidase) (NEU2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products