NEU2 (NM_005383) Human Mass Spec Standard

SKU
PH319858
NEU2 MS Standard C13 and N15-labeled recombinant protein (NP_005374)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219858]
Predicted MW 42.1 kDa
Protein Sequence
Protein Sequence
>RC219858 representing NM_005383
Red=Cloning site Green=Tags(s)

MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA
QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR
DLTDAAIGPAYREWSTFAVGPGHCLQLNDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH
FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP
SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF
GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005374
RefSeq Size 1143
RefSeq ORF 1140
Synonyms SIAL2
Locus ID 4759
UniProt ID Q9Y3R4
Cytogenetics 2q37.1
Summary This gene belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. Expression studies in COS7 cells confirmed that this gene encodes a functional sialidase. Its cytosolic localization was demonstrated by cell fractionation experiments. [provided by RefSeq, Jul 2008]
Protein Pathways Other glycan degradation, Sphingolipid metabolism
Write Your Own Review
You're reviewing:NEU2 (NM_005383) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401652 NEU2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401652 Transient overexpression lysate of sialidase 2 (cytosolic sialidase) (NEU2) 100 ug
$436.00
TP319858 Recombinant protein of human sialidase 2 (cytosolic sialidase) (NEU2), 20 µg 20 ug
$867.00
TP760824 Purified recombinant protein of Human sialidase 2 (cytosolic sialidase) (NEU2), full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.