OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TPM1 (NM_001018006) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP319606
Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 4, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA323683 Anti-TPM1 Rabbit Polyclonal Antibody
100 ul
$305.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "TPM1 or NM_001018006"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC219606 representing NM_001018006
Red=Cloning site Green=Tags(s)

MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDELDKYSEALKDAQEK
LELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEK
MEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGQVRQLEEQLRIMDQTLKALMAA
EDKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLE
LNNM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001018006
Locus ID 7168
UniProt ID P09493
Cytogenetics 15q22.2
RefSeq Size 1797
RefSeq ORF 852
Synonyms C15orf13; CMD1Y; CMH3; HEL-S-265; HTM-alpha; LVNC9; TMSA
Summary This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. provided by RefSeq, Jul 2008
Protein Categories Cardiovascular diseases, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome
Protein Pathways Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM)
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TPM1" proteins (23)
SKU Description Size Price
PH301262 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_000357) 10 ug
$3,360.00
PH318007 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018005) 10 ug
$3,360.00
PH318995 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018020) 10 ug
$3,360.00
PH319543 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018004) 10 ug
$3,360.00
PH319606 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018006) 10 ug
$3,360.00
PH319652 TPM1 MS Standard C13 and N15-labeled recombinant protein (NP_001018007) 10 ug
$3,360.00
LC422687 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422688 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422689 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422690 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422696 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC424765 Lyophilized TPM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422687 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422688 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422689 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 4 (as WB positive control) 100 ug
$436.00
LY422690 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422696 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 7 (as WB positive control) 100 ug
$436.00
LY424765 Transient overexpression lysate of tropomyosin 1 (alpha) (TPM1), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP301262 Recombinant protein of human tropomyosin 1 (alpha) (TPM1), transcript variant 5, 20 µg 20 ug
$737.00
TP318007 Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 1, 20 µg 20 ug
$737.00
TP318995 Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 7, 20 µg 20 ug
$737.00
TP319543 Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 3, 20 µg 20 ug
$737.00
TP319652 Purified recombinant protein of Homo sapiens tropomyosin 1 (alpha) (TPM1), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products