VNN3 (NM_018399) Human Recombinant Protein

CAT#: TP319141

Recombinant protein of human vanin 3 (VNN3), transcript variant 1, 20 µg

Product Images

Coomassie blue staining of purified VNN3 protein (Cat# TP319141). The protein was produced from HEK293T cells transfected with VNN3 cDNA clone (Cat# RC219141) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC219141 representing NM_018399
  Red=Cloning site Green=Tags(s)
  
  MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAK
  QGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANI
  GDKKPCNASDSQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIF
  TCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.4 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_060869
• Locus ID: 55350
• UniProt ID: Q9NY84
• Cytogenetics: 6q23.2
• Refseq Size: 1733
• Refseq ORF: 822
• Synonyms: HSA238982; MGC124285; MGC171203; OTTMUSP00000022908; PAGEL-beta; PAGEL-eta; PAGEL-zeta; vanin 3; vascular non-inflammatory molecule 3
• Summary: This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq, Apr 2014]
• Protein Families: Transmembrane