VNN3 (NM_018399) Human Mass Spec Standard

SKU
PH319141
VNN3 MS Standard C13 and N15-labeled recombinant protein (NP_060869)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219141]
Predicted MW 28.4 kDa
Protein Sequence
Protein Sequence
>RC219141 representing NM_018399
Red=Cloning site Green=Tags(s)

MIISHFPKCVAVFALLALSVGALDTFIAAVYEHAVILPNRTETPVSKEEALLLMNKNIDVLEKAVKLAAK
QGAHIIVTPEDGIYGWIFTRESIYPYLEDIPDPGVNWIPCRDPWRFGNTPVQQRLSCLAKDNSIYVVANI
GDKKPCNASDSQCPPDGRYQYNTDVVFDSQGKLLARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIF
TCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060869
RefSeq Size 1733
RefSeq ORF 822
Synonyms HSA238982; MGC124285; MGC171203; OTTMUSP00000022908; PAGEL-beta; PAGEL-eta; PAGEL-zeta; vanin 3; vascular non-inflammatory molecule 3
Locus ID 55350
UniProt ID Q9NY84
Cytogenetics 6q23.2
Summary This gene is the central gene in a cluster of three vanin genes on chromosome 6q23-q24. Extensive alternative splicing has been described; the two most common variants are represented as RefSeqs. [provided by RefSeq, Apr 2014]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:VNN3 (NM_018399) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402675 VNN3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402675 Transient overexpression lysate of vanin 3 (VNN3), transcript variant 1 100 ug
$436.00
TP319141 Recombinant protein of human vanin 3 (VNN3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.