OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLL1 (NM_001037495) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP318700
Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA375670 DYNLL1 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DYNLL1 or NM_001037495"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC218700 protein sequence
Red=Cloning site Green=Tags(s)

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET
KHFIYFYLGQVAILLFKSG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 10.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001032584
Locus ID 8655
UniProt ID P63167
Cytogenetics 12q24.31
RefSeq Size 747
RefSeq ORF 267
Synonyms DLC1; DLC8; DNCL1; DNCLC1; hdlc1; LC8; LC8a; PIN
Summary Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLL1" proteins (12)
SKU Description Size Price
PH318700 DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032584) 10 ug
$3,360.00
PH318752 DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_003737) 10 ug
$3,360.00
PH319822 DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032583) 10 ug
$3,360.00
LC418456 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421911 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421912 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418456 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY421911 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421912 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318752 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3, 20 µg 20 ug
$867.00
TP319822 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1, 20 µg 20 ug
$867.00
TP720193 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products