OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DYNLL1 (NM_001037495) Human Mass Spec Standard

Be the first to review this product
SKU
PH318700
DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032584)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA375670 DYNLL1 Rabbit polyclonal Antibody
100 ul
$410.00
LY418456 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 (as WB positive control) 100 ug
$436.00

Other products for "DYNLL1 or NM_001037495"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC218700
Predicted MW 10.4 kDa
Protein Sequence
Protein Sequence
>RC218700 protein sequence
Red=Cloning site Green=Tags(s)

MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHET
KHFIYFYLGQVAILLFKSG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032584
RefSeq Size 747
RefSeq ORF 267
Synonyms DLC1; DLC8; DNCL1; DNCLC1; hdlc1; LC8; LC8a; PIN
Locus ID 8655
UniProt ID P63167
Cytogenetics 12q24.31
Summary Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DYNLL1" proteins (12)
SKU Description Size Price
PH318752 DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_003737) 10 ug
$3,360.00
PH319822 DYNLL1 MS Standard C13 and N15-labeled recombinant protein (NP_001032583) 10 ug
$3,360.00
LC418456 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421911 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421912 Lyophilized DYNLL1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418456 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY421911 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421912 Transient overexpression lysate of dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP318700 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 2, 20 µg 20 ug
$867.00
TP318752 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 3, 20 µg 20 ug
$867.00
TP319822 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1, 20 µg 20 ug
$867.00
TP720193 Recombinant protein of human dynein, light chain, LC8-type 1 (DYNLL1), transcript variant 1 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products