PRPF31 (NM_015629) Human Recombinant Protein

CAT#: TP318307

Recombinant protein of human PRP31 pre-mRNA processing factor 31 homolog (S. cerevisiae) (PRPF31), 20 µg

Product Images

Coomassie blue staining of purified PRPF31 protein (Cat# TP318307). The protein was produced from HEK293T cells transfected with PRPF31 cDNA clone (Cat# RC218307) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC218307 representing NM_015629
  Red=Cloning site Green=Tags(s)
  
  MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEY
  ISKQAKASEVMGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVK
  ELGNSLDKCKNNENLQQILTNATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVES
  RMSFIAPNLSIIIGASTAAKIMGVAGGLTNLSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIV
  QSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYELKDEIERKFDKWQEPPPVKQVKPLPAPLDGQ
  RKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLGKSGSGRVRQTQVNEATKARI
  SKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYFSSMAEFLKVK
  GEKSGLMST
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056444
• Locus ID: 26121
• UniProt ID: Q8WWY3
• Cytogenetics: 19q13.42
• Refseq Size: 2153
• Refseq ORF: 1497
• Synonyms: NY-BR-99; PRP31; RP11; SNRNP61
• Summary: This gene encodes a component of the spliceosome complex and is one of several retinitis pigmentosa-causing genes. When the gene product is added to the spliceosome complex, activation occurs.[provided by RefSeq, Jan 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Spliceosome