OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HNF 4 alpha (HNF4A) (NM_000457) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP317863
Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA806582 HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HNF 4 alpha or NM_000457"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC217863 representing NM_000457
Red=Cloning site Green=Tags(s)

MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQ
IDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQ
MIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEW
PRPRGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEVI

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 52.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity HNF4A Activity Verified in a DNA-binding Assay: HNF4A (TP317863, transcript variant 2) activity was measured in a colorimetric DNA-binding assay. Purified HNF4A protein containing a C-terminal MYC/DDK tag was incubated with biotinylated double-stranded oligonucleotide containing the HNF4A consensus DNA-binding sequence (see below). Following incubation, the reaction was transferred to a streptavidin-coated microplate to allow capture of the DNA-protein complex. After washing, the captured protein was detected with an anti-DDK peroxidase conjugate and colorimetric signal detection with TMB. Specificity of the protein-DNA interaction was confirmed by carrying out the binding in the presence of an unlabeled competitor oligonucleotide and by comparison to binding to an oligonucleotide containing a mutation in the consensus binding sequence.
EMSA assay (PMID: 25598084)
Binding assay (PMID: 29642240)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000448
Locus ID 3172
UniProt ID P41235
Cytogenetics 20q13.12
RefSeq Size 4737
RefSeq ORF 1422
Synonyms FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14
Summary The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. provided by RefSeq, Apr 2012
Protein Categories Diabetes, Growth Factors, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HNF 4 alpha" proteins (17)
SKU Description Size Price
PH311443 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) 10 ug
$3,360.00
PH314914 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) 10 ug
$3,360.00
PH316588 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) 10 ug
$3,360.00
PH317863 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) 10 ug
$3,360.00
PH317924 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) 10 ug
$3,360.00
LC400161 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405861 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422283 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422284 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400161 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY405861 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY422283 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY422284 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP311443 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg 20 ug
$867.00
TP314914 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg 20 ug
$867.00
TP316588 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg 20 ug
$867.00
TP317924 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

Cooperative FOXA1–HNF4A binding emerges from motif spacing and nucleosome architecture
Wilson, Buck
bioRxiv (2026)
AI Summary: OriGene’s recombinant human full-length FOXA1 (TP306045) and HNF4A (TP317863) proteins were used in binding assays to investigate cooperative binding mechanisms between these transcription factors on nucleosomal DNA.
Snippet: Recombinant human full-length FOXA1 (Origene TP306045) and HNF4A (Origene TP317863) were used for binding reactions. … Binding reactions contained 30 nM purified nucleosome library and matched concentrations of FOXA1 and HNF4A at 0, 15, 30, 60, 120, and 240 nM in DNA-binding buffer (10 mM Tris–HCl pH 7.5, 50
Christmas disease in a Hovawart family resembling human hemophilia B Leyden is caused by a single nucleotide deletion in a highly conserved transcription factor binding site of the F9 gene promoter
Brenig, Steingräber, Shan et al
Haematologica (2019) 104 (11), 2307-2313 DOI: 10.3324/haematol.2018.215426
AI Summary: OriGene’s recombinant human HNF4α and human AR overexpression lysates were used in electrophoretic mobility shift assays to assess transcription factor binding to the F9 promoter, helping demonstrate the functional impact of the identified mutation.
Snippet: Belgium) harboring the overlapping HNF4α and AR binding sites (underlined). The position of the deleted C-nucleotide is indicated in bold and italics. Recombinant human HNF4α and human AR overexpression lysate were purchased from Origene Technologies Inc. (Rockville, MD, USA)
FigureFigureFigure
Sodium bicarbonate cotransporter NBCe2 gene variants increase sodium and bicarbonate transport in human renal proximal tubule cells
Gildea, Xu, Kemp et al
PLoS ONE (2018) 13 (4), e0189464 DOI: 10.1371/journal.pone.0189464
AI Summary: In this study, purified V5 myc epitope-tagged HNF4A protein from OriGene was used to investigate the binding of HNF4A to DNA sequences containing SLC4A5 gene variants, helping to elucidate the molecular mechanisms underlying increased sodium and bicarbonate transport in human renal proximal tubule cells.
Snippet: double-stranded DNA were generated using oligonucleotides matching either the WT G allele or variant A allele, and then annealed and incubated with 10 ng purified V5 myc epitope-tagged HNF4A protein (Origene). ChIP-grade streptavidin magnetic particles were incubated with 100 ng polyclonal mouse anti-myc antibody (Santa Cruz, clone 9E10) for 30 min and washed 3 times with PBS. They were incubated
Hepatocyte nuclear factor (HNF) 4α transactivation of cytochrome P450 (Cyp) 2d40 promoter is enhanced during pregnancy in mice
Ning, Koh, Pan et al
Biochem. Pharmacol. (2015)
Cited by 13
AI Summary: In this study, the recombinant HNF4α protein (MYC/DDK tagged; TP317863, OriGene Technologies) from OriGene was used in electrophoretic mobility shift assays to investigate the direct binding of HNF4α to the Cyp2d40 promoter, helping to elucidate the mechanism of gene regulation during pregnancy in mice.
Snippet: Table 1. 2.7. Electrophoretic mobility shift assay (EMSA). EMSA was performed as previously described [24]. Briefly, recombinant HNF4α protein (with C-terminal MYC/DDK tag;0.2 μg;TP317863, OriGene Technologies. Rockville ... Related articles All 3 versions Cite SaveSaving
Showing 1-4 of 4 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products