HNF 4 alpha (HNF4A) (NM_001030003) Human Mass Spec Standard

SKU
PH311443
HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC211443]
Predicted MW 48.8 kDa
Protein Sequence
Protein Sequence
>RC211443 representing NM_001030003
Red=Cloning site Green=Tags(s)

MVSVNAPLGAPVESSYDTSPSEGTNLNAPNSLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNH
MYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLS
RQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVALLRAHAGEHLLLGA
TKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYAYLKAIIFFDPDAKGL
SDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQE
MLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMSTPETPQPSPPGGSGSEPYKLLPGA
VATIVKPLSAIPQPTITKQEVI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025174
RefSeq Size 1339
RefSeq ORF 1326
Synonyms FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14
Locus ID 3172
UniProt ID P41235
Cytogenetics 20q13.12
Summary The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. [provided by RefSeq, Apr 2012]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Write Your Own Review
You're reviewing:HNF 4 alpha (HNF4A) (NM_001030003) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH314914 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180) 10 ug
$3,255.00
PH316588 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) 10 ug
$3,255.00
PH317863 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) 10 ug
$3,255.00
PH317924 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) 10 ug
$3,255.00
LC400161 HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405861 HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422283 HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422284 HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400161 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 100 ug
$665.00
LY405861 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 100 ug
$665.00
LY422283 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 100 ug
$665.00
LY422284 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 100 ug
$436.00
TP311443 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg 20 ug
$867.00
TP314914 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg 20 ug
$867.00
TP316588 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg 20 ug
$867.00
TP317863 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg 20 ug
$867.00
TP317924 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.