OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HNF 4 alpha (HNF4A) (NM_178849) Human Mass Spec Standard

Be the first to review this product
SKU
PH314914
HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849180)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA806582 HNF4A mouse monoclonal antibody, clone OTI2H2 (formerly 2H2) 100 ul
$447.00
LY400161 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 (as WB positive control) 100 ug
$665.00

Other products for "HNF 4 alpha or NM_178849"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214914
Predicted MW 51.6 kDa
Protein Sequence
Protein Sequence
>RC214914 representing NM_178849
Red=Cloning site Green=Tags(s)

MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGTNLNAPNSLGVSALCAICGDRATGK
HYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTR
RSSYEDSSLPSINALLQAEVLSRQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCE
LPLDDQVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPSRSCR
SMTMSMPTSKPSSSLTQMPRG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_849180
RefSeq Size 4707
RefSeq ORF 1392
Synonyms FRTS4; HNF4; HNF4a7; HNF4a8; HNF4a9; HNF4alpha; MODY; MODY1; NR2A1; NR2A21; TCF; TCF-14; TCF14
Locus ID 3172
UniProt ID F1D8S2
Cytogenetics 20q13.12
Summary The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms. provided by RefSeq, Apr 2012
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Nuclear Hormone Receptor, Transcription Factors
Protein Pathways Maturity onset diabetes of the young
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HNF 4 alpha" proteins (17)
SKU Description Size Price
PH311443 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025174) 10 ug
$3,360.00
PH316588 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_001025175) 10 ug
$3,360.00
PH317863 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_000448) 10 ug
$3,360.00
PH317924 HNF4A MS Standard C13 and N15-labeled recombinant protein (NP_849181) 10 ug
$3,360.00
LC400161 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405861 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422283 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422284 Lyophilized HNF4A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400161 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2 (as WB positive control) 100 ug
$665.00
LY405861 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3 (as WB positive control) 100 ug
$665.00
LY422283 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5 (as WB positive control) 100 ug
$665.00
LY422284 Transient overexpression lysate of hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6 (as WB positive control) 100 ug
$436.00
TP311443 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 5, 20 µg 20 ug
$867.00
TP314914 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 1, 20 µg 20 ug
$867.00
TP316588 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 6, 20 µg 20 ug
$867.00
TP317863 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 2, 20 µg 20 ug
$867.00
TP317924 Recombinant protein of human hepatocyte nuclear factor 4, alpha (HNF4A), transcript variant 3, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products