OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP15 (NM_177991) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316271
Recombinant protein of human dual specificity phosphatase 15 (DUSP15), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA370948 DUSP15 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DUSP15 or NM_177991"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216271 representing NM_177991
Red=Cloning site Green=Tags(s)

MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK
RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 14.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_817130
Locus ID 128853
UniProt ID Q9H1R2
Cytogenetics 20q11.21
RefSeq Size 1184
RefSeq ORF 396
Synonyms C20orf57; VHY
Summary The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2016
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP15" proteins (5)
SKU Description Size Price
PH316271 DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130) 10 ug
$3,360.00
LC405882 Lyophilized DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409154 Lyophilized DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405882 Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409154 Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 1 (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products