OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DUSP15 (NM_177991) Human Mass Spec Standard

Be the first to review this product
SKU
PH316271
DUSP15 MS Standard C13 and N15-labeled recombinant protein (NP_817130)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370948 DUSP15 rabbit polyclonal antibody
100 ul
$310.00
LY405882 Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "DUSP15 or NM_177991"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC216271
Predicted MW 14.5 kDa
Protein Sequence
Protein Sequence
>RC216271 representing NM_177991
Red=Cloning site Green=Tags(s)

MTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEFGWASSQKLRRQLEERFGESPFRDEEELRALLPLCK
RCRQGSATSASSAGPHSAASEGTVQRLVPRTPREAHRPLPLLARVKQTFSCLPRCLSRKGGK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_817130
RefSeq Size 1184
RefSeq ORF 396
Synonyms C20orf57; VHY
Locus ID 128853
UniProt ID Q9H1R2
Cytogenetics 20q11.21
Summary The protein encoded by this gene has both protein-tyrosine phophatase activity and serine/threonine-specific phosphatase activity, and therefore is known as a dual specificity phosphatase. This protein may function in the differentiation of oligodendrocytes. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2016
Protein Families Druggable Genome, Phosphatase
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DUSP15" proteins (5)
SKU Description Size Price
LC405882 Lyophilized DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409154 Lyophilized DUSP15 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY405882 Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY409154 Transient overexpression lysate of dual specificity phosphatase 15 (DUSP15), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP316271 Recombinant protein of human dual specificity phosphatase 15 (DUSP15), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products