OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PNS-Tau (NM_016835.5) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP316166
Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 1 (PNS-Tau/Big Tau), 20 µg
Size:
20 ug 100 ug 1 mg
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "Tau or NM_016835.5"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC216166 protein sequence
Red=Cloning site Green=Tags(s)

MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP
TAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQEPESGKVVQEGFLREP
GPPGLSHQLMSGMPGAPLLPEGPREATRQPSGTGPEDTEGGRHAPELLKHQLLGDLHQEGPPLKGAGGKE
RPGSKEEVDEDRDVDESSPQDSPPSKASPAQDGRPPQTAAREATSIPGFPAEGAIPLPVDFLSKVSTEIP
ASEPDGPSVGRAKGQDAPLEFTFHVEITPNVQKEQAHSEEHLGRAAFPGAPGEGPEARGPSLGEDTKEAD
LPEPSEKQPAAAPRGKPVSRVPQLKARMVSKSKDGTGSDDKKAKTSTRSSAKTLKNRPCLSPKHPTPGSS
DPLIQPSSPAVCPEPPSSPKHVSSVTSRTGSSGAKEMKLKGADGKTKIATPRGAAPPGQKGQANATRIPA
KTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRL
QTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPV
DLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRENAK
AKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQGL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 78.7 kDa
Concentration >50 ug/mL as determined by Microplate BCA Protein Assay method
Purity > 90% as determined by SDS-PAGE and Coomassie blue staining
Buffer 50 mM Tris-HCl, 100 mM glycine and 10% glycerol, pH 7.5
Stability Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_058519.3
UniProt ID P10636-1
RefSeq Size 3747
RefSeq ORF 2274
Protein Families Druggable Genome
Protein Pathways Alzheimer's disease, MAPK signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Tau" proteins (13)
SKU Description Size Price
PH313312 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_005901) 10 ug
$3,360.00
PH313364 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) 10 ug
$3,360.00
PH317773 MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) 10 ug
$3,360.00
LC401790 Lyophilized tau (MAPT) 2N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413819 Lyophilized tau (MAPT) 0N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413820 Lyophilized tau (MAPT), transcript variant 1 (PNS-Tau/Big Tau) HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC413823 Lyophilized tau (MAPT) 0N3R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426599 Lyophilized tau (MAPT) 1N4R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401790 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 2N4R (as WB positive control) 100 ug
$665.00
LY413819 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 0N4R (as WB positive control) 100 ug
$436.00
LY413820 Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 (PNS-Tau/Big Tau) (as WB positive control) 100 ug
$665.00
LY413823 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 0N3R (as WB positive control) 100 ug
$436.00
LY426599 Transient overexpression lysate of microtubule-associated protein tau (MAPT) 1N4R (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products