Tau (MAPT) (NM_005910) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC213312] |
Predicted MW | 45.7 kDa |
Protein Sequence |
Protein Sequence
>RC213312 representing NM_005910
Red=Cloning site Green=Tags(s) MAEPRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKESPLQTPTEDGSEEPGSETSDAKSTP TAEDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDK KAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRS RTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINK KLDLSNVQSKCGSKDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRV QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMV DSPQLATLADEVSASLAKQGL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_005901 |
RefSeq Size | 5731 |
RefSeq ORF | 1323 |
Synonyms | DDPAC; FTDP-17; MAPTL; MSTD; MTBT1; MTBT2; PPND; PPP1R103; TAU; tau-40 |
Locus ID | 4137 |
UniProt ID | P10636 |
Cytogenetics | 17q21.31 |
Summary | This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Alzheimer's disease, MAPK signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313364 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058525) | 10 ug |
$3,255.00
|
|
PH317773 | MAPT MS Standard C13 and N15-labeled recombinant protein (NP_058518) | 10 ug |
$3,255.00
|
|
LC401790 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC413819 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413820 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC413823 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC426599 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429527 | MAPT HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY401790 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 2 | 100 ug |
$665.00
|
|
LY413819 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 3 | 100 ug |
$436.00
|
|
LY413820 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 1 | 100 ug |
$665.00
|
|
LY413823 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 4 | 100 ug |
$436.00
|
|
LY426599 | Transient overexpression lysate of microtubule-associated protein tau (MAPT), transcript variant 5 | 100 ug |
$436.00
|
|
TP313312 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP313364 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 4, 20 µg | 20 ug |
$867.00
|
|
TP317773 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 3, 20 µg | 20 ug |
$867.00
|
|
TP720155 | Recombinant protein of human microtubule-associated protein tau (MAPT), transcript variant 6 | 10 ug |
$265.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.