OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BAT3 (BAG6) (NM_080703) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315646
Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 3, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA357917 BAG6 Antibody - C-terminal region
100 ul
$585.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "BAT3 or NM_080703"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215646 representing NM_080703
Red=Cloning site Green=Tags(s)

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQPPAVTPEPVAL
SSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRL
ESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLH
VVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEG
APPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFP
TAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPP
APATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGPGVASPTITVAM
PGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQ
GVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQ
PLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQF
NSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTT
MMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSR
GPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQG
EGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQR
AFADDP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 118.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_542434
Locus ID 7917
UniProt ID P46379
Cytogenetics 6p21.33
RefSeq Size 3755
RefSeq ORF 3378
Synonyms BAG-6; BAT3; D6S52E; G3
Summary This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Stem cell - Pluripotency
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "BAT3" proteins (13)
SKU Description Size Price
PH315646 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_542434) 10 ug
$3,360.00
PH319255 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_001092004) 10 ug
$3,360.00
PH321536 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_004630) 10 ug
$3,360.00
LC403316 Lyophilized BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC409113 Lyophilized BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC417855 Lyophilized BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420631 Lyophilized BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403316 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY409113 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY417855 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY420631 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 4 (as WB positive control) 100 ug
$665.00
TP319255 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 4, 20 µg 20 ug
$867.00
TP321536 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products