BAT3 (BAG6) (NM_001098534) Human Mass Spec Standard

SKU
PH319255
BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_001092004)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC219255]
Predicted MW 118.7 kDa
Protein Sequence
Protein Sequence
>RC219255 protein sequence
Red=Cloning site Green=Tags(s)

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQPPAVTPEPVAL
SSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVLQELQRL
ESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACTPPRHLH
VVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNVESSAEG
APPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQQVPGFP
TAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTPGMAPPP
APATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASPTITVAM
PGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEFFTSVVQ
GVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQ
PLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQF
NSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSLVSWLTT
MMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTAEEAMSR
GPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKRRKTMQG
EGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQRFPNAQR
AFADDP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001092004
RefSeq Size 3660
RefSeq ORF 3378
Synonyms BAG-6; BAT3; D6S52E; G3
Locus ID 7917
UniProt ID P46379
Cytogenetics 6p21.33
Summary This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:BAT3 (BAG6) (NM_001098534) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH315646 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_542434) 10 ug
$3,255.00
PH321536 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_004630) 10 ug
$3,255.00
LC403316 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409113 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417855 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420631 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403316 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 3 100 ug
$436.00
LY409113 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 2 100 ug
$436.00
LY417855 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 1 100 ug
$665.00
LY420631 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 4 100 ug
$665.00
TP315646 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319255 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP321536 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.