BAT3 (BAG6) (NM_004639) Human Recombinant Protein

SKU
TP321536
Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC221536 representing NM_004639
Red=Cloning site Green=Tags(s)

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDK
KLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNL
PSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMETLPYLQCRGGPQPQHSQPPPQPPAVT
PEPVALSSQTSEPVESEAPPREPMEAEEVEERAPAQNPELTPGPAPAGPTPAPETNAPNHPSPAEYVEVL
QELQRLESRLQPFLQRYYEVLGAAATTDYNNNHEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACT
PPRHLHVVRPMSHYTTPMVLQQAAIPIQINVGTTVTMTGNGTRPPPTPNAEAPPPGPGQASSVAPSSTNV
ESSAEGAPPPGPAPPPATSHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTLGQ
QVPGFPTAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQLLMQPVLVAQGTP
GMAPPPAPATASASAGTTNTATTAGPAPGGPAQPPPTPQPSMADLQFSQLLGNLLGPAGPGAGGSGVASP
TITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPPAPEQQTMPPPGSPSGGAGSPGGLGLESLSPEF
FTSVVQGVLSSLLGSLGARAGSSESIAAFIQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVML
LHGHFQPLQRLQPQLRSFFHQHYLGGQEPTPSNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLE
FLQEQFNSIAAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPSL
VSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRVGDPPQPLPEEPMEVQGAERASPEPQRENASPAPGTTA
EEAMSRGPPPAPEGGSRDEQDGASAETEPWAAAVPPEWVPIIQQDIQSQRKVKPQPPLSDAYLSGMPAKR
RKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDLEAPEVQESYRQQLRSDIQKRLQEDPNYSPQR
FPNAQRAFADDP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 119.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004630
Locus ID 7917
UniProt ID P46379
Cytogenetics 6p21.33
RefSeq Size 3832
RefSeq ORF 3396
Synonyms BAG-6; BAT3; D6S52E; G3
Summary This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Stem cell - Pluripotency
Write Your Own Review
You're reviewing:BAT3 (BAG6) (NM_004639) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH315646 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_542434) 10 ug
$3,255.00
PH319255 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_001092004) 10 ug
$3,255.00
PH321536 BAT3 MS Standard C13 and N15-labeled recombinant protein (NP_004630) 10 ug
$3,255.00
LC403316 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409113 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC417855 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC420631 BAG6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY403316 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 3 100 ug
$436.00
LY409113 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 2 100 ug
$436.00
LY417855 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 1 100 ug
$665.00
LY420631 Transient overexpression lysate of HLA-B associated transcript 3 (BAT3), transcript variant 4 100 ug
$665.00
TP315646 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP319255 Recombinant protein of human HLA-B associated transcript 3 (BAT3), transcript variant 4, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.