OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EBF4 (NM_020833) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315467
Purified recombinant protein of Homo sapiens early B-cell factor 4 (EBF4), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA332196 Rabbit Polyclonal Anti-EBF4 Antibody
100 ul
$575.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "EBF4 or NM_020833"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215467 representing NM_020833
Red=Cloning site Green=Tags(s)

MDALPRSGLNLKEEPLLPAGLGSVRSWMQGAGILDASTAAQSGVGLARAHFEKQPPSNLRKSNFFHFVLA
MYDRQGQPVEVERTAFIDFVEKDREPGAEKTNNGIHYRLRLVYNNGLRTEQDLYVRLIDSMSKQAIIYEG
QDKNPEMCRVLLTHEIMCSRCCDRKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKNAGNPRDMRRFQV
VVSTTVSVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEAATPCIKAISPGEGWTTGGATVIVIGDNFFDG
LQVVFGNVLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGCPGRFVYTALNEPTIDYGFQRLQ
KVIPRHPGDPERLPKEVLLKRAADLAEALYGVPGSNQELLLKRAADVAEALYSTPRAPGPLAPLAPSHPH
PAVVGINAFSSPLAIAVGDATPGPEPGYARSCSSASPRGFAPSPGSQQSGYGGGLGAGLGGYGAPGVAGL
GVPGSPSFLNGSTATSPFAKERLRPRAAPPKLPTPGLPQSPRRGASRPVF

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 58.7
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
Locus ID 57593
UniProt ID Q9BQW3
Cytogenetics 20p13
RefSeq Size 2814
RefSeq ORF 1620
Synonyms COE4; early B-cell factor 4; KIAA1442
Summary EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 PubMed 12139918).supplied by OMIM, Mar 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "EBF4" proteins (6)
SKU Description Size Price
PH326006 EBF4 MS Standard C13 and N15-labeled recombinant protein (NP_001103984) 10 ug
$3,360.00
LC412258 Lyophilized EBF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426327 Lyophilized EBF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY412258 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$665.00
LY426327 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$436.00
TP326006 Recombinant protein of human early B-cell factor 4 (EBF4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products