OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EBF4 Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA332196
Rabbit Polyclonal Anti-EBF4 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $575.00
5 Days*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY426327 Transient overexpression lysate of early B-cell factor 4 (EBF4) (as WB positive control) 100 ug
$436.00
TP315467 Purified recombinant protein of Homo sapiens early B-cell factor 4 (EBF4), 20 µg
20 ug
$867.00

View other "EBF4 or NM_001110514" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-EBF4 Antibody: synthetic peptide directed towards the middle region of human EBF4. Synthetic peptide located within the following region: LYPYIVEFEEEAKNPGLETHRKRKRSGNSDSIERDAAQEAEAGTGLEPGS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 64 kDa
Gene Name early B-cell factor 4
Database Link
Background EBF4 belongs to the COE family and contains 1 IPT/TIG domain. EBF4 is a transcriptional factor which recognizes variations of the palindromic sequence 5'-ATTCCCNNGGGAATT-3'. EBF4 belongs to the conserved Olf/EBF family of helix-loop-helix transcription factors, members of which play important roles in neural development and B-cell maturation (Wang et al., 2002 PubMed 12139918). supplied by OMIM. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-131 AB037863.1 1-131 132-137 AL035460.15 8605-8610 138-911 AB037863.1 132-905 912-2904 BC037555.1 12-2004 2905-2931 BC054347.1 1559-1585
Synonyms COE4; E-4; O
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Categories Intracellular Proteins, Transciption Factors
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products