OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HES5 (NM_001010926) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315311
Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA810555 HES5 mouse monoclonal antibody,clone OTI6F7 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "HES5 or NM_001010926"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215311 representing NM_001010926
Red=Cloning site Green=Tags(s)

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP
PPALSAKATAAAAAAHQPACGLWRPW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 18 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001010926
Locus ID 388585
UniProt ID Q5TA89
Cytogenetics 1p36.32
RefSeq Size 1306
RefSeq ORF 498
Synonyms bHLHb38
Summary This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. provided by RefSeq, Dec 2008
Protein Categories Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Notch signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HES5" proteins (4)
SKU Description Size Price
PH315311 HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926) 10 ug
$3,360.00
LC423234 Lyophilized HES5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423234 Transient overexpression lysate of hairy and enhancer of split 5 (Drosophila) (HES5) (as WB positive control) 100 ug
$436.00
TP760682 Purified recombinant protein of Human hairy and enhancer of split 5 (Drosophila) (HES5), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products