HES5 (NM_001010926) Human Recombinant Protein
SKU
TP315311M
Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5), 100 µg
$1,918.00
MSRP
$2,950.00
MSRP
$2,950.00
6 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC215311 representing NM_001010926
Red=Cloning site Green=Tags(s) MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP PPALSAKATAAAAAAHQPACGLWRPW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 18 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001010926 |
Locus ID | 388585 |
UniProt ID | Q5TA89 |
Cytogenetics | 1p36.32 |
RefSeq Size | 1306 |
RefSeq ORF | 498 |
Synonyms | bHLHb38 |
Summary | This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS |
Protein Pathways | Notch signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.