HES5 (NM_001010926) Human Mass Spec Standard

SKU PH315311

HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC215311]
• Predicted MW: 18 kDa
• Protein Sequence:
  Protein Sequence

  >RC215311 representing NM_001010926; Red=Cloning site Green=Tags(s); ; MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK; HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP; PPALSAKATAAAAAAHQPACGLWRPW; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001010926
• RefSeq Size: 1306
• RefSeq ORF: 498
• Synonyms: bHLHb38
• Locus ID: 388585
• UniProt ID: Q5TA89
• Cytogenetics: 1p36.32
• Summary: This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008]
• Protein Families: Druggable Genome, ES Cell Differentiation/IPS
• Protein Pathways: Notch signaling pathway