OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HES5 (NM_001010926) Human Mass Spec Standard

Be the first to review this product
SKU
PH315311
HES5 MS Standard C13 and N15-labeled recombinant protein (NP_001010926)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA810555 HES5 mouse monoclonal antibody,clone OTI6F7 100 ul
$447.00
LY423234 Transient overexpression lysate of hairy and enhancer of split 5 (Drosophila) (HES5) (as WB positive control) 100 ug
$436.00

Other products for "HES5 or NM_001010926"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215311
Predicted MW 18 kDa
Protein Sequence
Protein Sequence
>RC215311 representing NM_001010926
Red=Cloning site Green=Tags(s)

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP
PPALSAKATAAAAAAHQPACGLWRPW

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001010926
RefSeq Size 1306
RefSeq ORF 498
Synonyms bHLHb38
Locus ID 388585
UniProt ID Q5TA89
Cytogenetics 1p36.32
Summary This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. provided by RefSeq, Dec 2008
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Notch signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HES5" proteins (4)
SKU Description Size Price
LC423234 Lyophilized HES5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY423234 Transient overexpression lysate of hairy and enhancer of split 5 (Drosophila) (HES5) (as WB positive control) 100 ug
$436.00
TP315311 Recombinant protein of human hairy and enhancer of split 5 (Drosophila) (HES5), 20 µg 20 ug
$867.00
TP760682 Purified recombinant protein of Human hairy and enhancer of split 5 (Drosophila) (HES5), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products