HES5 (NM_001010926) Human Tagged ORF Clone

SKU
RC215311
HES5 (Myc-DDK-tagged)-Human hairy and enhancer of split 5 (Drosophila) (HES5)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HES5
Synonyms bHLHb38
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215311 representing NM_001010926
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCCCAGCACTGTGGCCGTGGAGCTGCTCAGCCCCAAAGAGAAAAACCGACTGCGGAAGCCGGTGG
TGGAGAAGATGCGCCGCGACCGCATCAACAGCAGCATCGAGCAGCTGAAGCTGCTGCTGGAGCAGGAGTT
CGCGCGGCACCAGCCCAACTCCAAGCTGGAGAAGGCCGACATCCTGGAGATGGCTGTCAGCTACCTGAAG
CACAGCAAAGCCTTCGTCGCCGCCGCCGGCCCCAAGAGCCTGCACCAGGACTACAGCGAAGGCTACTCGT
GGTGCCTGCAGGAGGCCGTGCAGTTCCTGACGCTCCACGCCGCCAGCGACACGCAGATGAAGCTGCTGTA
CCACTTCCAGCGGCCCCCGGCCGCGCCCGCCGCGCCCGCCAAGGAGCCCAAGGCGCCGGGCGCCGCGCCC
CCGCCCGCGCTCTCCGCCAAGGCCACCGCCGCCGCCGCCGCCGCGCACCAGCCCGCCTGCGGCCTCTGGC
GGCCCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215311 representing NM_001010926
Red=Cloning site Green=Tags(s)

MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLK
HSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAP
PPALSAKATAAAAAAHQPACGLWRPW

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001010926
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001010926.4
RefSeq Size 1306 bp
RefSeq ORF 501 bp
Locus ID 388585
UniProt ID Q5TA89
Cytogenetics 1p36.32
Protein Families Druggable Genome, ES Cell Differentiation/IPS
Protein Pathways Notch signaling pathway
MW 18 kDa
Summary This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer. [provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:HES5 (NM_001010926) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC215311L1 Lenti ORF clone of Human hairy and enhancer of split 5 (Drosophila) (HES5), Myc-DDK-tagged 10 ug
$450.00
RC215311L2 Lenti ORF clone of Human hairy and enhancer of split 5 (Drosophila) (HES5), mGFP tagged 10 ug
$450.00
RC215311L3 Lenti ORF clone of Human hairy and enhancer of split 5 (Drosophila) (HES5), Myc-DDK-tagged 10 ug
$450.00
RC215311L4 Lenti ORF clone of Human hairy and enhancer of split 5 (Drosophila) (HES5), mGFP tagged 10 ug
$450.00
RG215311 HES5 (tGFP-tagged) - Human hairy and enhancer of split 5 (Drosophila) (HES5) 10 ug
$489.00
SC301536 HES5 (untagged)-Human hairy and enhancer of split 5 (Drosophila) (HES5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.