OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SEPTIN4 (NM_080415) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315054
Recombinant protein of human septin 4 (SEPT4), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373093 Septin 4 Rabbit polyclonal Antibody
100 ul
$410.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SEPTIN4 or NM_080415"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215054 representing NM_080415
Red=Cloning site Green=Tags(s)

MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDN
QQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKST
LVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYI
DQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 30.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_536340
Locus ID 5414
UniProt ID O43236
Cytogenetics 17q22
RefSeq Size 1911
RefSeq ORF 822
Synonyms ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4
Summary This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. provided by RefSeq, Nov 2010
Protein Categories Cytokines, Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SEPTIN4" proteins (11)
SKU Description Size Price
PH313106 SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565) 10 ug
$3,360.00
PH315054 SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_536340) 10 ug
$3,360.00
LC401449 Lyophilized 42251 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403307 Lyophilized 42251 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC403308 Lyophilized 42251 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434256 Lyophilized 42251 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401449 Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY403307 Transient overexpression lysate of septin 4 (SEPT4), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY403308 Transient overexpression lysate of septin 4 (SEPT4), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY434256 Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP313106 Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products