SEPTIN4 (NM_080415) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC215054] |
Predicted MW | 30.6 kDa |
Protein Sequence |
Protein Sequence
>RC215054 representing NM_080415
Red=Cloning site Green=Tags(s) MIKRFLEDTTDDGELSKFVKDFSGNASCHPPEAKTWASRPQVPEPRPQAPDLYDDDLEFRPPSRPQSSDN QQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKST LVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYI DQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGYGPSLRLLAPPGAVKGTGQEHQGQGCH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_536340 |
RefSeq Size | 1911 |
RefSeq ORF | 822 |
Synonyms | ARTS; BRADEION; C17orf47; CE5B3; H5; hCDCREL-2; hucep-7; MART; PNUTL2; SEP4; SEPT4 |
Locus ID | 5414 |
UniProt ID | O43236 |
Cytogenetics | 17q22 |
Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. This gene is highly expressed in brain and heart. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. One of the isoforms (known as ARTS) is distinct; it is localized to the mitochondria, and has a role in apoptosis and cancer. [provided by RefSeq, Nov 2010] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH313106 | SEPT4 MS Standard C13 and N15-labeled recombinant protein (NP_004565) | 10 ug |
$3,255.00
|
|
LC401449 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC403307 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC403308 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434256 | 42251 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY401449 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 1 | 100 ug |
$665.00
|
|
LY403307 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 2 | 100 ug |
$436.00
|
|
LY403308 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 3 | 100 ug |
$436.00
|
|
LY434256 | Transient overexpression lysate of septin 4 (SEPT4), transcript variant 4 | 100 ug |
$436.00
|
|
TP313106 | Recombinant protein of human septin 4 (SEPT4), transcript variant 1, 20 µg | 20 ug |
$737.00
|
|
TP315054 | Recombinant protein of human septin 4 (SEPT4), transcript variant 2, 20 µg | 20 ug |
$737.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.