OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC12 (NM_201262) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP315035
Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA366152 DNAJC12 rabbit polyclonal antibody
100 ul
$310.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "DNAJC12 or NM_201262"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC215035 representing NM_201262
Red=Cloning site Green=Tags(s)

MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE
SRARYDHWRRSQMSMPFQQWEALNDSVKTVGFSLGAT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 12.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_957714
Locus ID 56521
UniProt ID Q9UKB3
Cytogenetics 10q21.3
RefSeq Size 786
RefSeq ORF 321
Synonyms HPANBH4; JDP1
Summary This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC12" proteins (7)
SKU Description Size Price
PH301931 DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_068572) 10 ug
$3,360.00
PH315035 DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) 10 ug
$3,360.00
LC404589 Lyophilized DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411920 Lyophilized DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404589 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY411920 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301931 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products