OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DNAJC12 (NM_021800) Human Mass Spec Standard

Be the first to review this product
SKU
PH301931
DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_068572)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA366152 DNAJC12 rabbit polyclonal antibody
100 ul
$310.00
LY411920 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "DNAJC12 or NM_021800"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201931
Predicted MW 23.4 kDa
Protein Sequence
Protein Sequence
>RC201931 protein sequence
Red=Cloning site Green=Tags(s)

MDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEE
SRARYDHWRRSQMSMPFQQWEALNDSVKTSMHWVVRGKKDLMLEESDKTHTTKMENEECNEQRERKKEEL
ASTAEKTEQKEPKPLEKSVSPQNSDSSGFADVNGWHLRFRWSKDAPSELLRKFRNYEI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_068572
RefSeq Size 1218
RefSeq ORF 594
Synonyms HPANBH4; JDP1
Locus ID 56521
UniProt ID Q9UKB3
Cytogenetics 10q21.3
Summary This gene encodes a member of a subclass of the HSP40/DnaJ protein family. Members of this family of proteins are associated with complex assembly, protein folding, and export. Two transcript variants encoding distinct isoforms have been identified for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DNAJC12" proteins (7)
SKU Description Size Price
PH315035 DNAJC12 MS Standard C13 and N15-labeled recombinant protein (NP_957714) 10 ug
$3,360.00
LC404589 Lyophilized DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC411920 Lyophilized DNAJC12 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404589 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY411920 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301931 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 1, 20 µg 20 ug
$867.00
TP315035 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily C, member 12 (DNAJC12), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products