HELT (NM_001029887) Human Recombinant Protein

CAT#: TP315012

Recombinant protein of human HES/HEY-like transcription factor (HELT), 20 µg

Product Images

Coomassie blue staining of purified HELT protein (Cat# TP315012). The protein was produced from HEK293T cells transfected with HELT cDNA clone (Cat# RC215012) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC215012 representing NM_001029887
  Red=Cloning site Green=Tags(s)
  
  MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRI
  NRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEIL
  EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSK
  ARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAP
  VPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001025058
• Locus ID: 391723
• UniProt ID: A6NFD8
• Cytogenetics: 4q35.1
• Refseq Size: 984
• Refseq ORF: 981
• Synonyms: bHLHb44; HCM1228; HESL; Mgn
• Summary: Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.[UniProtKB/Swiss-Prot Function]