HELT (NM_001029887) Human Mass Spec Standard

SKU
PH315012
HELT MS Standard C13 and N15-labeled recombinant protein (NP_001025058)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215012]
Predicted MW 35.6 kDa
Protein Sequence
Protein Sequence
>RC215012 representing NM_001029887
Red=Cloning site Green=Tags(s)

MSDKLKERKVSRLSPNGTCALVVEASDSPTRHLGGPMAGKCPHGTLSVEESRVRTPVSHKVIEKRRRDRI
NRCLNELGKTVPMALAKQGEPQEALAQIRSRVRSLVLSSATVPDQQALGRCEGPFLLLQSSGKLEKAEIL
EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSK
ARLGAEPAFPPLGSLPEPDFSYQLHPAGPEFAGHSPGEAAVFPQGSGAGPFPWPPGAARSPALPYLPSAP
VPLASPAQQHSPFLTPVQGLDRHYLNLIGHAHPNALNLHTPQHPPVL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001025058
RefSeq Size 984
RefSeq ORF 981
Synonyms bHLHb44; HCM1228; HESL; Mgn
Locus ID 391723
UniProt ID A6NFD8
Cytogenetics 4q35.1
Summary Transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3'.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:HELT (NM_001029887) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422265 HELT HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY422265 Transient overexpression lysate of HES/HEY-like transcription factor (HELT) 100 ug
$436.00
TP315012 Recombinant protein of human HES/HEY-like transcription factor (HELT), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.