OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IGF1 Receptor (IGF1R) (NM_000875) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314928
Recombinant protein of human insulin-like growth factor 1 receptor (IGF1R), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA807835 IGF1R mouse monoclonal antibody, clone OTI4C4 (formerly 4C4) 100 ul
$447.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "IGF1 Receptor or NM_000875"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214928 representing NM_000875
Red=Cloning site Green=Tags(s)

MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLHILLISKAEDY
RSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIFEMTNLKDIGLYNLRNITRGA
IRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGDLCPGTMEEKPMCEKTTINNEYNYRCWTTNR
CQKMCPSTCGKRACTENNECCHPECLGSCSAPDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRD
FCANILSAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQML
QGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCES
DVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNK
DVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVK
WNPPSLPNGNLSYYIVRWQRQPQDGYLYRHNYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCC
ACPKTEAEKQAEKEEAEYRKVFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEE
LETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSL
SGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHRKRNNSRLGNGVLYASVNPEY
FSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNE
ASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIA
DGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFT
TYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPG
PGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 156.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000866
Locus ID 3480
UniProt ID P08069
Cytogenetics 15q26.3
RefSeq Size 4989
RefSeq ORF 4101
Synonyms CD221; IGFIR; IGFR; JTK13
Summary This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. provided by RefSeq, May 2014
Protein Categories ADC Targets, Cancer: Gastrointestinal, Cancer: Lung, Cancer: Sarcoma, CD Markers, Cytokines, Endocrine and metabolic diseases, Enzyme: Kinases, Growth Factors, Intracellular Proteins, Membrane Proteins
Protein Families Druggable Genome, Protein Kinase, Transmembrane
Protein Pathways Adherens junction, Colorectal cancer, Endocytosis, Focal adhesion, Glioma, Long-term depression, Melanoma, Oocyte meiosis, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "IGF1 Receptor" proteins (5)
SKU Description Size Price
PH314928 IGF1R MS Standard C13 and N15-labeled recombinant protein (NP_000866) 10 ug
$3,360.00
LC400311 Lyophilized IGF1R HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY400311 Transient overexpression lysate of insulin-like growth factor 1 receptor (IGF1R) (as WB positive control) 100 ug
$665.00
TP700109 Purified recombinant protein of Human insulin-like growth factor 1 receptor (IGF1R), with C-terminal DDK/His tag, expressed in human cells 20 ug
$900.00
TP710101 Recombinant protein of human insulin-like growth factor 1 receptor (IGF1R), residues 741-935aa, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

Non-peptidyl small molecule, adenosine, 5'-Se-methyl-5'-seleno-, 2',3'-diacetate, activates insulin receptor and attenuates hyperglycemia in type 2 diabetic Leprdb/db mice
Lan, Lei, Yiannikouris et al
Cell. Mol. Life Sci. (2019) 77 (8), 1623-1643 DOI: 10.1007/s00018-019-03249-4
AI Summary: OriGene’s recombinant human IGF1R protein (Cat. TP314928) was used to study in vitro phosphorylation of IGF1R, helping to assess the specificity of the tested compound’s action on insulin receptor signaling in this study.
Snippet: Experiments were repeated three times. Similarly, in vitro phosphorylation of IGF1R proteins was studied using recombinant human IGF1R proteins contain- ing both alpha and beta subunits (400 ng IGF1R protein/ reaction, Cat. TP314928, Origene, Rockville, MD, USA
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products