OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SETD3 (NM_032233) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314566
Recombinant protein of human SET domain containing 3 (SETD3), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "SETD3 or NM_032233"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214566 representing NM_032233
Red=Cloning site Green=Tags(s)

MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVT
FDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLG
PLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQY
KNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHT
NGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLY
AMKAEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSW
DNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSAAVNREYYR
QQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENSIP
NGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 67.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_115609
Locus ID 84193
UniProt ID Q86TU7
Cytogenetics 14q32.2
RefSeq Size 2905
RefSeq ORF 1782
Synonyms C14orf154; hSETD3
Summary Protein-histidine N-methyltransferase that specifically mediates methylation of actin at 'His-73' (PubMed:30526847, PubMed:30626964, PubMed:30785395). Histidine methylation of actin is required for smooth muscle contraction of the laboring uterus during delivery (PubMed:30626964). Does not have protein-lysine N-methyltransferase activity and probably only catalyzes histidine methylation of actin (PubMed:30626964, PubMed:30785395).UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "SETD3" proteins (5)
SKU Description Size Price
PH314566 SETD3 MS Standard C13 and N15-labeled recombinant protein (NP_115609) 10 ug
$3,360.00
LC404739 Lyophilized SETD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC410259 Lyophilized SETD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404739 Transient overexpression lysate of SET domain containing 3 (SETD3), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY410259 Transient overexpression lysate of SET domain containing 3 (SETD3), transcript variant 1 (as WB positive control) 100 ug
$665.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products