SETD3 (NM_032233) Human Mass Spec Standard

SKU
PH314566
SETD3 MS Standard C13 and N15-labeled recombinant protein (NP_115609)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214566]
Predicted MW 67.1 kDa
Protein Sequence
Protein Sequence
>RC214566 representing NM_032233
Red=Cloning site Green=Tags(s)

MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKIRKKQKGLSVT
FDGKREDYFPDLMKWASENGASVEGFEMVNFKEEGFGLRATRDIKAEELFLWVPRKLLMTVESAKNSVLG
PLYSQDRILQAMGNIALAFHLLCERASPNSFWQPYIQTLPSEYDTPLYFEEDEVRYLQSTQAIHDVFSQY
KNTARQYAYFYKVIQTHPHANKLPLKDSFTYEDYRWAVSSVMTRQNQIPTEDGSRVTLALIPLWDMCNHT
NGLITTGYNLEDDRCECVALQDFRAGEQIYIFYGTRSNAEFVIHSGFFFDNNSHDRVKIKLGVSKSDRLY
AMKAEVLARAGIPTSSVFALHFTEPPISAQLLAFLRVFCMTEEELKEHLLGDSAIDRIFTLGNSEFPVSW
DNEVKLWTFLEDRASLLLKTYKTTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSAAVNREYYR
QQMEEKAPLPKYEESNLGLLESSVGDSRLPLVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENSIP
NGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115609
RefSeq Size 2905
RefSeq ORF 1782
Synonyms C14orf154; hSETD3
Locus ID 84193
UniProt ID Q86TU7
Cytogenetics 14q32.2
Summary Protein-histidine N-methyltransferase that specifically mediates methylation of actin at 'His-73' (PubMed:30526847, PubMed:30626964, PubMed:30785395). Histidine methylation of actin is required for smooth muscle contraction of the laboring uterus during delivery (PubMed:30626964). Does not have protein-lysine N-methyltransferase activity and probably only catalyzes histidine methylation of actin (PubMed:30626964, PubMed:30785395).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:SETD3 (NM_032233) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404739 SETD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC410259 SETD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404739 Transient overexpression lysate of SET domain containing 3 (SETD3), transcript variant 2 100 ug
$436.00
LY410259 Transient overexpression lysate of SET domain containing 3 (SETD3), transcript variant 1 100 ug
$665.00
TP314566 Recombinant protein of human SET domain containing 3 (SETD3), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.