OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PAX8 (NM_013953) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314188
Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA308698 Rabbit polyclonal antibody to PAX8CC (paired box 8)
100 ul
$665.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "PAX8 or NM_013953"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214188 representing NM_013953
Red=Cloning site Green=Tags(s)

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS
IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI
DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWWGPRCPDTHPTSPPADR
AAMPPLPSQAWWQEVNTLAMPMATPPTPPTARPGASPTPAC

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_039247
Locus ID 7849
UniProt ID Q06710
Cytogenetics 2q14.1
RefSeq Size 3755
RefSeq ORF 963
Summary This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. provided by RefSeq, Mar 2010
Protein Categories ADC Targets, Cancer: Endocrine, Endocrine and metabolic diseases, Intracellular Proteins, Transciption Factors
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "PAX8" proteins (14)
SKU Description Size Price
PH300651 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) 10 ug
$3,360.00
PH314188 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247) 10 ug
$3,360.00
PH315690 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) 10 ug
$3,360.00
LC401173 Lyophilized PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415550 Lyophilized PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415551 Lyophilized PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC415574 Lyophilized PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401173 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A (as WB positive control) 100 ug
$436.00
LY415550 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C (as WB positive control) 100 ug
$436.00
LY415551 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D (as WB positive control) 100 ug
$436.00
LY415574 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E (as WB positive control) 100 ug
$436.00
TP300651 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg 20 ug
$867.00
TP315690 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E, 20 µg 20 ug
$867.00
TP762414 Purified recombinant protein of Human paired box 8 (PAX8), transcript variant PAX8A, Cys238-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products