PAX8 (NM_013953) Human Mass Spec Standard

SKU
PH314188
PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214188]
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC214188 representing NM_013953
Red=Cloning site Green=Tags(s)

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS
IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI
DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWWGPRCPDTHPTSPPADR
AAMPPLPSQAWWQEVNTLAMPMATPPTPPTARPGASPTPAC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_039247
RefSeq Size 3755
RefSeq ORF 963
Locus ID 7849
UniProt ID Q06710
Cytogenetics 2q14.1
Summary This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Write Your Own Review
You're reviewing:PAX8 (NM_013953) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH300651 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) 10 ug
$3,255.00
PH315690 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) 10 ug
$3,255.00
LC401173 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415550 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415551 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415574 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429402 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401173 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A 100 ug
$436.00
LY415550 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C 100 ug
$436.00
LY415551 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D 100 ug
$436.00
LY415574 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E 100 ug
$436.00
TP300651 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg 20 ug
$867.00
TP314188 Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D, 20 µg 20 ug
$867.00
TP315690 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E, 20 µg 20 ug
$867.00
TP762414 Purified recombinant protein of Human paired box 8 (PAX8), transcript variant PAX8A, Cys238-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.