PAX8 (NM_003466) Human Recombinant Protein

SKU
TP300651
Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC200651 protein sequence
Red=Cloning site Green=Tags(s)

MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS
IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF
NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI
DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP
SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS
VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP
NSSLLSSPYYYSSTSRPSAPPTTATAFDHL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003457
Locus ID 7849
UniProt ID Q06710
Cytogenetics 2q14.1
RefSeq Size 4065
RefSeq ORF 1350
Summary This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Pathways in cancer, Thyroid cancer
Write Your Own Review
You're reviewing:PAX8 (NM_003466) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH300651 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_003457) 10 ug
$3,255.00
PH314188 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_039247) 10 ug
$3,255.00
PH315690 PAX8 MS Standard C13 and N15-labeled recombinant protein (NP_054698) 10 ug
$3,255.00
LC401173 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415550 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415551 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC415574 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429402 PAX8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401173 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A 100 ug
$436.00
LY415550 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8C 100 ug
$436.00
LY415551 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8D 100 ug
$436.00
LY415574 Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8E 100 ug
$436.00
TP314188 Purified recombinant protein of Homo sapiens paired box 8 (PAX8), transcript variant PAX8D, 20 µg 20 ug
$867.00
TP315690 Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8E, 20 µg 20 ug
$867.00
TP762414 Purified recombinant protein of Human paired box 8 (PAX8), transcript variant PAX8A, Cys238-End, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$249.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.