PAX8 (NM_003466) Human Recombinant Protein
SKU
TP300651L
Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A, 1 mg
$9,200.00
6 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC200651 protein sequence
Red=Cloning site Green=Tags(s) MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGS IRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPF NLPMDSCVATKSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDDSDQDSCRLSI DSQSSSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGLYPLPLLNSTLDDGKATLTP SNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSAFLDLQQVGSGVPPFNAFPHAAS VYGQFTGQALLSGREMVGPTLPGYPPHIPTSGQGSYASSAIAGMVAGSEYSGNAYGHTPYSSYSEAWRFP NSSLLSSPYYYSSTSRPSAPPTTATAFDHL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 48 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_003457 |
Locus ID | 7849 |
UniProt ID | Q06710 |
Cytogenetics | 2q14.1 |
RefSeq Size | 4065 |
RefSeq ORF | 1350 |
Summary | This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Pathways in cancer, Thyroid cancer |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.