OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MUSTN1 (NM_205853) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP314142
Recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "MUSTN1 or NM_205853"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC214142 protein sequence
Red=Cloning site Green=Tags(s)

MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE
KPKAGPTKSVFG

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 8.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_995325
Locus ID 389125
UniProt ID Q8IVN3
Cytogenetics 3p21.1
RefSeq Size 742
RefSeq ORF 246
Synonyms MUSTANG
Summary May be involved in the development and regeneration of the musculoskeletal system.UniProtKB/Swiss-Prot Function
Protein Categories Intracellular Proteins
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MUSTN1" proteins (4)
SKU Description Size Price
PH314142 MUSTN1 MS Standard C13 and N15-labeled recombinant protein (NP_995325) 10 ug
$3,360.00
LC404202 Lyophilized MUSTN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404202 Transient overexpression lysate of musculoskeletal, embryonic nuclear protein 1 (MUSTN1) (as WB positive control) 100 ug
$436.00
TP710365 Purified recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products