OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MUSTN1 (NM_205853) Human Mass Spec Standard

Be the first to review this product
SKU
PH314142
MUSTN1 MS Standard C13 and N15-labeled recombinant protein (NP_995325)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY404202 Transient overexpression lysate of musculoskeletal, embryonic nuclear protein 1 (MUSTN1) (as WB positive control) 100 ug
$436.00

Other products for "MUSTN1 or NM_205853"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC214142
Predicted MW 8.9 kDa
Protein Sequence
Protein Sequence
>RC214142 protein sequence
Red=Cloning site Green=Tags(s)

MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE
KPKAGPTKSVFG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_995325
RefSeq Size 742
RefSeq ORF 246
Synonyms MUSTANG
Locus ID 389125
UniProt ID Q8IVN3
Cytogenetics 3p21.1
Summary May be involved in the development and regeneration of the musculoskeletal system.UniProtKB/Swiss-Prot Function
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MUSTN1" proteins (4)
SKU Description Size Price
LC404202 Lyophilized MUSTN1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY404202 Transient overexpression lysate of musculoskeletal, embryonic nuclear protein 1 (MUSTN1) (as WB positive control) 100 ug
$436.00
TP314142 Recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), 20 µg 20 ug
$867.00
TP710365 Purified recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$540.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products