CA6 (NM_001215) Human Recombinant Protein

CAT#: TP314135

Recombinant protein of human carbonic anhydrase VI (CA6), 20 µg

Product Images

Coomassie blue staining of purified CA6 protein (Cat# TP314135). The protein was produced from HEK293T cells transfected with CA6 cDNA clone (Cat# RC214135) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC214135 representing NM_001215
  Red=Cloning site Green=Tags(s)
  
  MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTG
  YETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIV
  HYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQ
  HYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPN
  QEYTLGSEFQFYLHKIEEILDYLRRALN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 33.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001206
• Locus ID: 765
• UniProt ID: P23280, B4DUH8
• Cytogenetics: 1p36.23
• Refseq Size: 1339
• Refseq ORF: 924
• Synonyms: CA-VI; GUSTIN
• Summary: The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: Nitrogen metabolism