CA6 (NM_001215) Human Mass Spec Standard

SKU
PH314135
CA6 MS Standard C13 and N15-labeled recombinant protein (NP_001206)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214135]
Predicted MW 35.37 kDa
Protein Sequence
Protein Sequence
>RC214135 representing NM_001215
Red=Cloning site Green=Tags(s)

MRALVLLLSLFLLGGQAQHVSDWTYSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTG
YETQAGEFPMVNNGHTVQISLPSTMRMTVADGTVYIAQQMHFHWGGASSEISGSEHTVDGIRHVIEIHIV
HYNSKYKSYDIAQDAPDGLAVLAAFVEVKNYPENTYYSNFISHLANIKYPGQRTTLTGLDVQDMLPRNLQ
HYYTYHGSLTTPPCTENVHWFVLADFVKLSRTQVWKLENSLLDHRNKTIHNDYRRTQPLNHRVVESNFPN
QEYTLGSEFQFYLHKIEEILDYLRRALN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001206
RefSeq Size 1339
RefSeq ORF 924
Synonyms CA-VI; GUSTIN
Locus ID 765
UniProt ID P23280
Cytogenetics 1p36.23
Summary The protein encoded by this gene is one of several isozymes of carbonic anhydrase. This protein is found only in salivary glands and saliva and protein may play a role in the reversible hydratation of carbon dioxide though its function in saliva is unknown. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Nitrogen metabolism
Write Your Own Review
You're reviewing:CA6 (NM_001215) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC420071 CA6 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY420071 Transient overexpression lysate of carbonic anhydrase VI (CA6) 100 ug
$436.00
TP314135 Recombinant protein of human carbonic anhydrase VI (CA6), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.