OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GLUT4 (SLC2A4) (NM_001042) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP313717
Recombinant protein of human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), 20 µg
Size:
20 ug 1 mg 100 ug
  $737.00
4 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336786 Rabbit Polyclonal Glut4 Antibody
100 ul
$705.00
TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "GLUT4 or NM_001042"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC213717 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001033
Locus ID 6517
UniProt ID P14672
Cytogenetics 17p13.1
RefSeq Size 2128
RefSeq ORF 1527
Synonyms GLUT4
Summary This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). provided by RefSeq, Jul 2008
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, Insulin signaling pathway, Type II diabetes mellitus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GLUT4" proteins (3)
SKU Description Size Price
PH313717 SLC2A4 MS Standard C13 and N15-labeled recombinant protein (NP_001033) 10 ug
$3,360.00
LC420842 Lyophilized SLC2A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420842 Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4) (as WB positive control) 100 ug
$436.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products