OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GLUT4 (SLC2A4) (NM_001042) Human Mass Spec Standard

Be the first to review this product
SKU
PH313717
SLC2A4 MS Standard C13 and N15-labeled recombinant protein (NP_001033)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA336786 Rabbit Polyclonal Glut4 Antibody
100 ul
$705.00
LY420842 Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4) (as WB positive control) 100 ug
$436.00

Other products for "GLUT4 or NM_001042"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC213717
Predicted MW 54.6 kDa
Protein Sequence
Protein Sequence
>RC213717 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MPSGFQQIGSEDGEPPQQRVTGTLVLAVFSAVLGSLQFGYNIGVINAPQKVIEQSYNETW
LGRQGPEGPSSIPPGTLTTLWALSVAIFSVGGMISSFLIGIISQWLGRKRAMLVNNVLAV
LGGSLMGLANAAASYEMLILGRFLIGAYSGLTSGLVPMYVGEIAPTHLRGALGTLNQLAI
VIGILIAQVLGLESLLGTASLWPLLLGLTVLPALLQLVLLPFCPESPRYLYIIQNLEGPA
RKSLKRLTGWADVSGVLAELKDEKRKLERERPLSLLQLLGSRTHRQPLIIAVVLQLSQQL
SGINAVFYYSTSIFETAGVGQPAYATIGAGVVNTVFTLVSVLLVERAGRRTLHLLGLAGM
CGCAILMTVALLLLERVPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAM
AVAGFSNWTSNFIIGMGFQYVAEAMGPYVFLLFAVLLLGFFIFTFLRVPETRGRTFDQIS
AAFHRTPSLLEQEVKPSTELEYLGPDEND

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001033
RefSeq Size 2128
RefSeq ORF 1527
Synonyms GLUT4
Locus ID 6517
UniProt ID P14672
Cytogenetics 17p13.1
Summary This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). provided by RefSeq, Jul 2008
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway, Insulin signaling pathway, Type II diabetes mellitus
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GLUT4" proteins (3)
SKU Description Size Price
LC420842 Lyophilized SLC2A4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY420842 Transient overexpression lysate of solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4) (as WB positive control) 100 ug
$436.00
TP313717 Recombinant protein of human solute carrier family 2 (facilitated glucose transporter), member 4 (SLC2A4), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products